(data stored in ACNUC7421 zone)

EMBL: CP000529.PE170

CP000529.PE170       Location/Qualifiers
FT   CDS             complement(183921..184220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0172"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: pol:Bpro_0221 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35497"
FT                   /db_xref="GOA:A1VIL9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIL9"
FT                   /protein_id="ABM35497.1"
FT                   /translation="MALTFKDIERVANLARLELRPDETEHTLSQLNGFFALVEQMQAVN
FT                   TDGVEPLAHPAALLGEVALRLREDIASEPNQREASQASAPAVERGLFLVPKVIE"
     MALTFKDIER VANLARLELR PDETEHTLSQ LNGFFALVEQ MQAVNTDGVE PLAHPAALLG        60
     EVALRLREDI ASEPNQREAS QASAPAVERG LFLVPKVIE                               99
//

If you have problems or comments...

PBIL Back to PBIL home page