(data stored in ACNUC7421 zone)

EMBL: CP000529.PE173

CP000529.PE173       Location/Qualifiers
FT   CDS             186561..187079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0175"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="PFAM: Rod shape-determining protein MreD; KEGG:
FT                   pol:Bpro_0224 putative rod shape-determining MreD
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35500"
FT                   /db_xref="GOA:A1VIM2"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM2"
FT                   /protein_id="ABM35500.1"
FT                   /translation="MIMRSGQQLLLPASPVFIWCTLIAALLLDMLPLGRIPWMPEFLAL
FT                   VLVFWSVHQPLKVGIGIAFMFGLAIDVHQTSLLGQHAFSYTMLSFLAAMIQRRLLWFTV
FT                   PLQALQVLPLFAAAHGAEIILRLLGGGVFPGWIVLLAPLAEALLWPVASVLLLVPQLRT
FT                   PDRDENRPL"
     MIMRSGQQLL LPASPVFIWC TLIAALLLDM LPLGRIPWMP EFLALVLVFW SVHQPLKVGI        60
     GIAFMFGLAI DVHQTSLLGQ HAFSYTMLSF LAAMIQRRLL WFTVPLQALQ VLPLFAAAHG       120
     AEIILRLLGG GVFPGWIVLL APLAEALLWP VASVLLLVPQ LRTPDRDENR PL               172
//

If you have problems or comments...

PBIL Back to PBIL home page