(data stored in ACNUC7421 zone)

EMBL: CP000529.PE174

CP000529.PE174       Location/Qualifiers
FT   CDS             187285..189336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0176"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   pol:Bpro_0225 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35501"
FT                   /db_xref="GOA:A1VIM3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM3"
FT                   /protein_id="ABM35501.1"
FT                   /translation="MTELRNVEADLSRFRTRVLVAGLVVFLCFSLVASRLVYLQVYRHE
FT                   DLRAQAESNRTAIVPIVPNRGLILDRNGIVLASNYSAYTLEITPSKVENLDETIAALEK
FT                   LVDIQPRDKRRFKRLREESKSFESIPLRTRLSDEEVARFAARRFAFPGVDIKARLFRSY
FT                   PYGELGSHVVGYIGRINQLEKDAIEEREEEGNYRGTDYIGKLGVEQSFEQQLHGQTGVE
FT                   QMETSAGGRALRKLATSPATPGNTVMLSLDIGLQKLVEDMFGTRRGALVALDPRNGEVL
FT                   AFVSKPTFDPNLFVDGIDQESWQALNESIDKPLLNRALRGTYPPGSTYKPFMALAALQT
FT                   GTRSPGAIIHDPGFYMFGGHRFGSPENERGGAMDMNRAIVESSNVYFYSLANELGVDAI
FT                   HDFMAPLGFGQLTGIDINGEVRGVLPSQAWKRGYFKRVEQQKWFAGETISLGIGQGYNS
FT                   FTMLQLAQATATLANNGLRHKPRLVMGTQDTVTRALHPLPADPPVDLGYKPENVAIVRK
FT                   ALVGVTQGGTSTKVFAGAQYLSGGKTGTAQAVTIGQKDKYNKSRMEEHQRDHAVYMAFA
FT                   PADNPKIALAVIVENAGWGAGVAAPIARRVFDYVLMGQYPSEEDMLAVQAGRAAAPIGK
FT                   PRLAAEMNALLVDDTPGGSPSAAPQKAEPPAVAARTRPFSRQNRPRPP"
     MTELRNVEAD LSRFRTRVLV AGLVVFLCFS LVASRLVYLQ VYRHEDLRAQ AESNRTAIVP        60
     IVPNRGLILD RNGIVLASNY SAYTLEITPS KVENLDETIA ALEKLVDIQP RDKRRFKRLR       120
     EESKSFESIP LRTRLSDEEV ARFAARRFAF PGVDIKARLF RSYPYGELGS HVVGYIGRIN       180
     QLEKDAIEER EEEGNYRGTD YIGKLGVEQS FEQQLHGQTG VEQMETSAGG RALRKLATSP       240
     ATPGNTVMLS LDIGLQKLVE DMFGTRRGAL VALDPRNGEV LAFVSKPTFD PNLFVDGIDQ       300
     ESWQALNESI DKPLLNRALR GTYPPGSTYK PFMALAALQT GTRSPGAIIH DPGFYMFGGH       360
     RFGSPENERG GAMDMNRAIV ESSNVYFYSL ANELGVDAIH DFMAPLGFGQ LTGIDINGEV       420
     RGVLPSQAWK RGYFKRVEQQ KWFAGETISL GIGQGYNSFT MLQLAQATAT LANNGLRHKP       480
     RLVMGTQDTV TRALHPLPAD PPVDLGYKPE NVAIVRKALV GVTQGGTSTK VFAGAQYLSG       540
     GKTGTAQAVT IGQKDKYNKS RMEEHQRDHA VYMAFAPADN PKIALAVIVE NAGWGAGVAA       600
     PIARRVFDYV LMGQYPSEED MLAVQAGRAA APIGKPRLAA EMNALLVDDT PGGSPSAAPQ       660
     KAEPPAVAAR TRPFSRQNRP RPP                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page