(data stored in ACNUC7421 zone)

EMBL: CP000529.PE179

CP000529.PE179       Location/Qualifiers
FT   CDS             194426..195370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0181"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bxe:Bxe_A0014 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35506"
FT                   /db_xref="GOA:A1VIM8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM8"
FT                   /protein_id="ABM35506.1"
FT                   /translation="MSLNFDPQTLRAFVAVARHGNVSRAAERLHLSQPAVSLQLKGLAA
FT                   NTGLTLFTRTPQGLTLTRDGAALLPQAEKALAALADFAQAALGLHSSVRGTLRIGTILD
FT                   PEFTRLGAFLKELVEAAPQIDTELRQGMSGNVLAQIVRGDLDVGFYLDRPEKSEANQGF
FT                   VQDGRAQAAIDFEVMELTRFTYRVIAPAGWGQQVQGRDWKALAALPWLATPPASVHHRL
FT                   LSRVFGAASLTGLEPRRVALVDQEASMLDLVKSGVGLSLARDSIAIRESQAHGLVVADR
FT                   VSLDCVLSFICLKARVAEPVVASAWGALAQAWR"
     MSLNFDPQTL RAFVAVARHG NVSRAAERLH LSQPAVSLQL KGLAANTGLT LFTRTPQGLT        60
     LTRDGAALLP QAEKALAALA DFAQAALGLH SSVRGTLRIG TILDPEFTRL GAFLKELVEA       120
     APQIDTELRQ GMSGNVLAQI VRGDLDVGFY LDRPEKSEAN QGFVQDGRAQ AAIDFEVMEL       180
     TRFTYRVIAP AGWGQQVQGR DWKALAALPW LATPPASVHH RLLSRVFGAA SLTGLEPRRV       240
     ALVDQEASML DLVKSGVGLS LARDSIAIRE SQAHGLVVAD RVSLDCVLSF ICLKARVAEP       300
     VVASAWGALA QAWR                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page