(data stored in ACNUC7421 zone)

EMBL: CP000529.PE18

CP000529.PE18        Location/Qualifiers
FT   CDS             16663..18579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0019"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   pol:Bpro_0037 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35345"
FT                   /db_xref="GOA:A1VI67"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VI67"
FT                   /protein_id="ABM35345.1"
FT                   /translation="MAKTNLSVDAADLTSRITRTPFPGSRKIYIEGSRPDIRVPFREVT
FT                   LTDTLVAEGSETRREANPPLRLFDSSGVYTDPAASIDITRGLSPLRGAWINERQDTEAL
FT                   PGISSAYGRERLNDPALSALRMAHAPVPRRAKAGANVSQMHYARQGIITPEMEYIAIRE
FT                   NLVRAQLAERLATERVPKTGHSFGASIPKDITAEFVRDEVARGRAVIPNNINHPETEPM
FT                   IIGRNFLIKVNANIGNSAVTSSIEEEVDKLAWSIRWGADTVMDLSTGENIHETREWILR
FT                   NSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVRLAYVPLT
FT                   ANRLTGIVSRGGSIMAKWCLSHHKESFLYEHFEEICEIMKAYDVCFSLGDGLRPGSIAD
FT                   ANDEAQFAELHTLGELTQIAWKHDVQVMIEGPGHVPLQLVKENVEKQLEACFEAPFYTL
FT                   GPLITDISPGYDHISSAMGAANIGWYGTAMLCYVTPKEHLGLPNRDDVKQGLIAYKIAA
FT                   HAGDLAKGYPGAQMWDNAVSKARFEFRWEDQFRLAIDPDTAMAYHDETLPKENAKVAHF
FT                   CSMCGPKFCSMKISQEVREFARLNPSTTTLAKAPGVIPIQQVSSGFEEKAEEFRKGGNE
FT                   IYS"
     MAKTNLSVDA ADLTSRITRT PFPGSRKIYI EGSRPDIRVP FREVTLTDTL VAEGSETRRE        60
     ANPPLRLFDS SGVYTDPAAS IDITRGLSPL RGAWINERQD TEALPGISSA YGRERLNDPA       120
     LSALRMAHAP VPRRAKAGAN VSQMHYARQG IITPEMEYIA IRENLVRAQL AERLATERVP       180
     KTGHSFGASI PKDITAEFVR DEVARGRAVI PNNINHPETE PMIIGRNFLI KVNANIGNSA       240
     VTSSIEEEVD KLAWSIRWGA DTVMDLSTGE NIHETREWIL RNSPVPIGTV PIYQALEKVN       300
     GKAEDLTWEI FRDTLIEQAE QGVDYFTIHA GVRLAYVPLT ANRLTGIVSR GGSIMAKWCL       360
     SHHKESFLYE HFEEICEIMK AYDVCFSLGD GLRPGSIADA NDEAQFAELH TLGELTQIAW       420
     KHDVQVMIEG PGHVPLQLVK ENVEKQLEAC FEAPFYTLGP LITDISPGYD HISSAMGAAN       480
     IGWYGTAMLC YVTPKEHLGL PNRDDVKQGL IAYKIAAHAG DLAKGYPGAQ MWDNAVSKAR       540
     FEFRWEDQFR LAIDPDTAMA YHDETLPKEN AKVAHFCSMC GPKFCSMKIS QEVREFARLN       600
     PSTTTLAKAP GVIPIQQVSS GFEEKAEEFR KGGNEIYS                               638
//

If you have problems or comments...

PBIL Back to PBIL home page