(data stored in ACNUC7421 zone)

EMBL: CP000529.PE181

CP000529.PE181       Location/Qualifiers
FT   CDS             196623..197420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0183"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0231 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35508"
FT                   /db_xref="GOA:A1VIN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN0"
FT                   /protein_id="ABM35508.1"
FT                   /translation="MTVKTEPVVEIRKLWTIFQNDDKEAVIHKDLDLTVERGAIMSLVG
FT                   GSGTGKTVLLRQMLGLETPARGEITVLGKPAAELGKRGAAMRVGMLFQQGALFSAFTVL
FT                   ENIAFPLRELKCLPGELIREAAMVKLQMVGLPPDAADKMPSDLSGGMIKRVALARALIM
FT                   DPPLLLLDEPTAGLDPESADSFCELLRSLHQGMCLTVVMVTHDLDTIFELSTRVAVLAQ
FT                   QKVIINDTPQKVVAFEHPFIREFFLGERGQRAMALLTPASSPI"
     MTVKTEPVVE IRKLWTIFQN DDKEAVIHKD LDLTVERGAI MSLVGGSGTG KTVLLRQMLG        60
     LETPARGEIT VLGKPAAELG KRGAAMRVGM LFQQGALFSA FTVLENIAFP LRELKCLPGE       120
     LIREAAMVKL QMVGLPPDAA DKMPSDLSGG MIKRVALARA LIMDPPLLLL DEPTAGLDPE       180
     SADSFCELLR SLHQGMCLTV VMVTHDLDTI FELSTRVAVL AQQKVIINDT PQKVVAFEHP       240
     FIREFFLGER GQRAMALLTP ASSPI                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page