(data stored in ACNUC7421 zone)

EMBL: CP000529.PE182

CP000529.PE182       Location/Qualifiers
FT   CDS             197434..198366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0184"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: pol:Bpro_0232 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35509"
FT                   /db_xref="GOA:A1VIN1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN1"
FT                   /protein_id="ABM35509.1"
FT                   /translation="MENKAHALIAGAFVVVVAALLALLGVWLTRDDTQRDLYEMSTAET
FT                   ISGLQPQAVVRFRGVPVGKVERIGFDDKVKGNVLIRVSIDRAAPMMQSTFATVASQGVT
FT                   GLGFIQLDDNGESTQRLVPNDDDPPRIPLKPGTLDKLLKQSDAIFTQAEQAATRINQLL
FT                   SRQNEEAINTAVTQLAEAASSINRLAKGLEPTVATLPALSRDSSATMKALKSASDEVGL
FT                   TARRLNEKGGPLDKLRDGGTALAAGVETFSAATLPKLGEVADETARTMRQLRRTVNAVD
FT                   DNPQALIFGNGPAVPGPGEAGFSADGVKK"
     MENKAHALIA GAFVVVVAAL LALLGVWLTR DDTQRDLYEM STAETISGLQ PQAVVRFRGV        60
     PVGKVERIGF DDKVKGNVLI RVSIDRAAPM MQSTFATVAS QGVTGLGFIQ LDDNGESTQR       120
     LVPNDDDPPR IPLKPGTLDK LLKQSDAIFT QAEQAATRIN QLLSRQNEEA INTAVTQLAE       180
     AASSINRLAK GLEPTVATLP ALSRDSSATM KALKSASDEV GLTARRLNEK GGPLDKLRDG       240
     GTALAAGVET FSAATLPKLG EVADETARTM RQLRRTVNAV DDNPQALIFG NGPAVPGPGE       300
     AGFSADGVKK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page