(data stored in ACNUC7421 zone)

EMBL: CP000529.PE184

CP000529.PE184       Location/Qualifiers
FT   CDS             complement(199168..199800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0186"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: pol:Bpro_0238 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35511"
FT                   /db_xref="GOA:A1VIN3"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN3"
FT                   /protein_id="ABM35511.1"
FT                   /translation="MDFKPLVTLLAIVNPLAIVPFFIHYTQGFSTPQRQRTVVVASFSA
FT                   FVVIAVSALLGLQILEFFGISLASFQVGGGLLLLISAMNMLNAQPAEAKPLTNEYEDGA
FT                   EKAARGASIAVVPLTIPLLTGPATMSTVVIYAEKAKTFLQLGTLVGYGMVIGLATALCF
FT                   SLAEPISRVLGKTGINVMTRLMGLILAALAVEVMADGLGKLFPILRH"
     MDFKPLVTLL AIVNPLAIVP FFIHYTQGFS TPQRQRTVVV ASFSAFVVIA VSALLGLQIL        60
     EFFGISLASF QVGGGLLLLI SAMNMLNAQP AEAKPLTNEY EDGAEKAARG ASIAVVPLTI       120
     PLLTGPATMS TVVIYAEKAK TFLQLGTLVG YGMVIGLATA LCFSLAEPIS RVLGKTGINV       180
     MTRLMGLILA ALAVEVMADG LGKLFPILRH                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page