(data stored in ACNUC7421 zone)

EMBL: CP000529.PE187

CP000529.PE187       Location/Qualifiers
FT   CDS             complement(201305..201871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0189"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   tbd:Tbd_1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35514"
FT                   /db_xref="GOA:A1VIN6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN6"
FT                   /protein_id="ABM35514.1"
FT                   /translation="MSILSRIHAGPGATQASADDLTRDNVESMRRVEEQAMAKRSRADR
FT                   IAAFVASFCGSMPFVWLHVLLFFVWLALNSWPGIHHFDPYPFTFLTLVVSLEAIFLSAF
FT                   ILISQNYELRISDRRNQLDLQINLLTEQENTKMLQLLEQIAAKVGVDVSGDAELRFLKQ
FT                   VTHPEKLIAQIEHAQQERPLKTSSV"
     MSILSRIHAG PGATQASADD LTRDNVESMR RVEEQAMAKR SRADRIAAFV ASFCGSMPFV        60
     WLHVLLFFVW LALNSWPGIH HFDPYPFTFL TLVVSLEAIF LSAFILISQN YELRISDRRN       120
     QLDLQINLLT EQENTKMLQL LEQIAAKVGV DVSGDAELRF LKQVTHPEKL IAQIEHAQQE       180
     RPLKTSSV                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page