(data stored in ACNUC7421 zone)

EMBL: CP000529.PE189

CP000529.PE189       Location/Qualifiers
FT   CDS             complement(202703..203818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0191"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: pol:Bpro_0244 Mg2+ transporter protein, CorA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35516"
FT                   /db_xref="GOA:A1VIN8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN8"
FT                   /protein_id="ABM35516.1"
FT                   /translation="MRVFTINSGSQGVIETDALPAELPPHGFIWIACARREFEVMLAPI
FT                   QAALQRLCGTQLVDLHVSDLLNNQLPSHYDYTSQYDMLVFRRLAAGQTETDLSQPGEPL
FT                   HQPARRSGPPVLKRIDTSPVGFAVFDRVLLTVHPAGCSVREAYALKLLNATSPEARANG
FT                   VKLPASPADLMLRIVNQMVDGYLALRRELTRQMDHWQYELLNPNARFNNWSAVLDARLA
FT                   LHLLDEICEDQRAALQDWLDSIETWPDAGTPGAQRERELLKVRSRDVLEHIERVVHHVR
FT                   RMEQSAETAVQMHFSAQSHRTNDIMRTLTALTAVFLPLNLVTGFFGMNFEFLPAIHSSA
FT                   GFWWTFSLMLLLVIVVVSVFWRKQYLARTSR"
     MRVFTINSGS QGVIETDALP AELPPHGFIW IACARREFEV MLAPIQAALQ RLCGTQLVDL        60
     HVSDLLNNQL PSHYDYTSQY DMLVFRRLAA GQTETDLSQP GEPLHQPARR SGPPVLKRID       120
     TSPVGFAVFD RVLLTVHPAG CSVREAYALK LLNATSPEAR ANGVKLPASP ADLMLRIVNQ       180
     MVDGYLALRR ELTRQMDHWQ YELLNPNARF NNWSAVLDAR LALHLLDEIC EDQRAALQDW       240
     LDSIETWPDA GTPGAQRERE LLKVRSRDVL EHIERVVHHV RRMEQSAETA VQMHFSAQSH       300
     RTNDIMRTLT ALTAVFLPLN LVTGFFGMNF EFLPAIHSSA GFWWTFSLML LLVIVVVSVF       360
     WRKQYLARTS R                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page