(data stored in ACNUC7421 zone)

EMBL: CP000529.PE191

CP000529.PE191       Location/Qualifiers
FT   CDS             205309..205737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0193"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   pol:Bpro_0246 conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35518"
FT                   /db_xref="GOA:A1VIP0"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP0"
FT                   /protein_id="ABM35518.1"
FT                   /translation="MLWVKSFHIVFIASWFAGLFYLPRIFVNLAMVPPHSIAERERLIL
FT                   MAGKLMRFTTLLAIPAVALGLWLYLGYGIGRGPGNGWMHAKLAVVALVIGYHHACGRML
FT                   AKFVAKRNTHSHVWLRWFNEVPVLLLVAAVILVVVKPF"
     MLWVKSFHIV FIASWFAGLF YLPRIFVNLA MVPPHSIAER ERLILMAGKL MRFTTLLAIP        60
     AVALGLWLYL GYGIGRGPGN GWMHAKLAVV ALVIGYHHAC GRMLAKFVAK RNTHSHVWLR       120
     WFNEVPVLLL VAAVILVVVK PF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page