(data stored in ACNUC7421 zone)

EMBL: CP000529.PE195

CP000529.PE195       Location/Qualifiers
FT   CDS             208232..209440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0197"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11, D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: pol:Bpro_0250 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35522"
FT                   /db_xref="GOA:A1VIP4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP4"
FT                   /protein_id="ABM35522.1"
FT                   /translation="MQCFLKAPAGLRGLAATFVLLVSVALPAAHAQAPQVPEIAARSYL
FT                   LLDVTANQILAAKDIDSPVEPASLTKLMTEYLVFDALKSKKITLQQTFGVSQRAWKMPG
FT                   SRMFIDPKMQVPVEDLIKGMIVQSGNDATMALAEGVGGTAEHFVELMNQQAKALGMKST
FT                   SYKNPEGLTEAGHITTARDLSILSTRLMSDFPDYIGYSAIKKYRYPGTPATNDTNRNTL
FT                   LFRDPTVDGLKTGHTNAAGYCMIATAKREFPNLGAAGKPGGRRLLAIVLGTTSDSARAT
FT                   ESQKLLNWGYTAFEAVKLFDAGQAVVTPAVWKGKDAVVKLGRPEAIVVAVTAGSASRLK
FT                   TQVARPEPLVAPFKKGQPVGSLKIMLGDNPAPMAEVPLVALETVEEAGIMGRAWDSIRL
FT                   WIK"
     MQCFLKAPAG LRGLAATFVL LVSVALPAAH AQAPQVPEIA ARSYLLLDVT ANQILAAKDI        60
     DSPVEPASLT KLMTEYLVFD ALKSKKITLQ QTFGVSQRAW KMPGSRMFID PKMQVPVEDL       120
     IKGMIVQSGN DATMALAEGV GGTAEHFVEL MNQQAKALGM KSTSYKNPEG LTEAGHITTA       180
     RDLSILSTRL MSDFPDYIGY SAIKKYRYPG TPATNDTNRN TLLFRDPTVD GLKTGHTNAA       240
     GYCMIATAKR EFPNLGAAGK PGGRRLLAIV LGTTSDSARA TESQKLLNWG YTAFEAVKLF       300
     DAGQAVVTPA VWKGKDAVVK LGRPEAIVVA VTAGSASRLK TQVARPEPLV APFKKGQPVG       360
     SLKIMLGDNP APMAEVPLVA LETVEEAGIM GRAWDSIRLW IK                          402
//

If you have problems or comments...

PBIL Back to PBIL home page