(data stored in ACNUC7421 zone)

EMBL: CP000529.PE20

CP000529.PE20        Location/Qualifiers
FT   CDS             19946..20155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0021"
FT                   /product="sulfur carrier protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: hch:HCH_00139 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35347"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI69"
FT                   /protein_id="ABM35347.1"
FT                   /translation="MTDFEISLNGERIATQAATLQGLLLERGYDLKSAFACAINSGFVP
FT                   RPQWPERSLQGGDRIDVVTPITGG"
     MTDFEISLNG ERIATQAATL QGLLLERGYD LKSAFACAIN SGFVPRPQWP ERSLQGGDRI        60
     DVVTPITGG                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page