(data stored in ACNUC7421 zone)

EMBL: CP000529.PE200

CP000529.PE200       Location/Qualifiers
FT   CDS             214321..214635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0202"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: pol:Bpro_0255
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35527"
FT                   /db_xref="GOA:A1VIP9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIP9"
FT                   /protein_id="ABM35527.1"
FT                   /translation="MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPT
FT                   RMKRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ
FT                   "
     MATKQKIRIR LKAFDYKLID QSAAEIVDTA KRTGAIVKGP VPLPTRMKRF DILRSPHVNK        60
     TSRDQLEIRT HQRLMDIVDP TDKTVDALMK LDLPAGVDVE IKLQ                        104
//

If you have problems or comments...

PBIL Back to PBIL home page