(data stored in ACNUC7421 zone)

EMBL: CP000529.PE203

CP000529.PE203       Location/Qualifiers
FT   CDS             216171..216497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0205"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: pol:Bpro_0258
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35530"
FT                   /db_xref="GOA:A1VIQ2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ2"
FT                   /protein_id="ABM35530.1"
FT                   /translation="MSAVNAQTKYDEGRLMQVLVAPIVSEKATMIAEKSNSVTFKVLQD
FT                   ATKYEIKAAVELMFKVNVKAVAVLNIKGKTKRFGKSVGRRDNLRKAYVTLQAGQELNLG
FT                   GESA"
     MSAVNAQTKY DEGRLMQVLV APIVSEKATM IAEKSNSVTF KVLQDATKYE IKAAVELMFK        60
     VNVKAVAVLN IKGKTKRFGK SVGRRDNLRK AYVTLQAGQE LNLGGESA                    108
//

If you have problems or comments...

PBIL Back to PBIL home page