(data stored in ACNUC7421 zone)

EMBL: CP000529.PE209

CP000529.PE209       Location/Qualifiers
FT   CDS             219307..219510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0211"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: pol:Bpro_0264
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35536"
FT                   /db_xref="GOA:A1VIQ8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ8"
FT                   /protein_id="ABM35536.1"
FT                   /translation="MNTTELRQKDVDGLKAEVKELQKAHFGLRMQKATQQLTNTSTLRS
FT                   TRRAIARAKTILAETIVKQGAK"
     MNTTELRQKD VDGLKAEVKE LQKAHFGLRM QKATQQLTNT STLRSTRRAI ARAKTILAET        60
     IVKQGAK                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page