(data stored in ACNUC7421 zone)

EMBL: CP000529.PE21

CP000529.PE21        Location/Qualifiers
FT   CDS             20158..20976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0022"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   pol:Bpro_0040 thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35348"
FT                   /db_xref="GOA:A1VI70"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI70"
FT                   /protein_id="ABM35348.1"
FT                   /translation="MSNPMNSSIAHGSPWSVAGTTLSSRFFLGTSHYPSPQVLGDAVRA
FT                   SGTEVLTVGLRRLQPETGGGSSFWQRIQALGCHILPNTAGCHSAEEAITLAQMAREIFG
FT                   TRWIKLEVIGDDYTLQPDTVATLEAATALAKDGFSVFAYTTDDLVMAQRLHAAGCAAVM
FT                   PWAAPIGTGRGPLNPYALETMRRRLPDAVLIVDAGLGRPSHAAQVMELGFDAVLLNTAV
FT                   AQAGDPVRMARAFADGVAAGRAAYESTPMPERAAAQASTSTVGVPFWHAT"
     MSNPMNSSIA HGSPWSVAGT TLSSRFFLGT SHYPSPQVLG DAVRASGTEV LTVGLRRLQP        60
     ETGGGSSFWQ RIQALGCHIL PNTAGCHSAE EAITLAQMAR EIFGTRWIKL EVIGDDYTLQ       120
     PDTVATLEAA TALAKDGFSV FAYTTDDLVM AQRLHAAGCA AVMPWAAPIG TGRGPLNPYA       180
     LETMRRRLPD AVLIVDAGLG RPSHAAQVME LGFDAVLLNT AVAQAGDPVR MARAFADGVA       240
     AGRAAYESTP MPERAAAQAS TSTVGVPFWH AT                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page