(data stored in ACNUC7421 zone)

EMBL: CP000529.PE211

CP000529.PE211       Location/Qualifiers
FT   CDS             219963..220469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0213"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pol:Bpro_0266
FT                   alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35538"
FT                   /db_xref="GOA:A1VIR0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR0"
FT                   /protein_id="ABM35538.1"
FT                   /translation="MIKVGDTLPAATLMEFVEVEGNGCSLGPNPVDVAQASAGKTIALF
FT                   AVPGAFTPTCSAKHVPGYVAKFAEFKAAGVDEIWCLSVNDAFVMGAWARDQKTEGKVRM
FT                   LADGDAAFAQATGLTLDLNGKGLGLRSNRYSMLVKDGKVASLNIEGPGKFEVSDADTLL
FT                   AQVAA"
     MIKVGDTLPA ATLMEFVEVE GNGCSLGPNP VDVAQASAGK TIALFAVPGA FTPTCSAKHV        60
     PGYVAKFAEF KAAGVDEIWC LSVNDAFVMG AWARDQKTEG KVRMLADGDA AFAQATGLTL       120
     DLNGKGLGLR SNRYSMLVKD GKVASLNIEG PGKFEVSDAD TLLAQVAA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page