(data stored in ACNUC7421 zone)

EMBL: CP000529.PE215

CP000529.PE215       Location/Qualifiers
FT   CDS             complement(222550..223065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0217"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pol:Bpro_0270
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35542"
FT                   /db_xref="GOA:A1VIR4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR4"
FT                   /protein_id="ABM35542.1"
FT                   /translation="MIKISPVAVCRMVLAGALALGGAAFLAGCSGAQAAPESTFVLLDG
FT                   SKQTTADLKGKVTLVNFWATSCVTCVAEMPKIIATHNKYKTRGYDTLAVAMSYDPPSYV
FT                   VNYAETRQLPFKVAIDNTGANAKAWGDVQLTPTTFLVNKRGQIVKQFVGEPDFAALHQL
FT                   IEKLLAET"
     MIKISPVAVC RMVLAGALAL GGAAFLAGCS GAQAAPESTF VLLDGSKQTT ADLKGKVTLV        60
     NFWATSCVTC VAEMPKIIAT HNKYKTRGYD TLAVAMSYDP PSYVVNYAET RQLPFKVAID       120
     NTGANAKAWG DVQLTPTTFL VNKRGQIVKQ FVGEPDFAAL HQLIEKLLAE T                171
//

If you have problems or comments...

PBIL Back to PBIL home page