(data stored in ACNUC7421 zone)

EMBL: CP000529.PE218

CP000529.PE218       Location/Qualifiers
FT   CDS             225345..225941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0220"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: pol:Bpro_0280 OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35545"
FT                   /db_xref="GOA:A1VIR7"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR7"
FT                   /protein_id="ABM35545.1"
FT                   /translation="MKKQLIAAAVLSTLLSGAAFAQQATEGPWMVRARAVHLDSANGDS
FT                   TGLGLSVNNKWMPEVDISYFVNKNVAVELVLTVPQKHTMYSNGVEIGTLKHLPPTLLGQ
FT                   YHFDMNGFKPYVGAGVNFTRFSGVNLLGGVATVDKNSWGPALQVGVDIPLSKGLYLNLD
FT                   VKKVYIRTDVAAAGTKIGEFKVDPLLVGVGLGWRF"
     MKKQLIAAAV LSTLLSGAAF AQQATEGPWM VRARAVHLDS ANGDSTGLGL SVNNKWMPEV        60
     DISYFVNKNV AVELVLTVPQ KHTMYSNGVE IGTLKHLPPT LLGQYHFDMN GFKPYVGAGV       120
     NFTRFSGVNL LGGVATVDKN SWGPALQVGV DIPLSKGLYL NLDVKKVYIR TDVAAAGTKI       180
     GEFKVDPLLV GVGLGWRF                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page