(data stored in ACNUC7421 zone)

EMBL: CP000529.PE222

CP000529.PE222       Location/Qualifiers
FT   CDS             229582..230601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0224"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein, LacI;
FT                   KEGG: bcn:Bcen_4095 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35549"
FT                   /db_xref="GOA:A1VIS1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS1"
FT                   /protein_id="ABM35549.1"
FT                   /translation="MDLKQLSASLGLSPTTVSRALNGYPEVSERTRERVIEAAKEVGYE
FT                   PNVTARRLARGAVDAIGIVHPTGAGHLDDPRFLEVVDGLTERFSKAGIDLLIASARQKE
FT                   EVATYKRLLQGRRVDGFIVHHTRRVDPRLDYLQECGAPFVAYGRTDTPDSYAWFDFDNA
FT                   LGSSLAVRRLQEFGHRRIAYMHAPLELHFAYQRYQGYLDAMHAAGLPVDPGLVVPAGFG
FT                   RRGGYEAMKTLLDRAEGPTAVIVDNNLCGVGVLRCALDAGLKIGRQLSLIVYDGVPVDS
FT                   VVTSVQVTSIEQPTSYAVGVQLAELMIGVLAGQPVQELQTLWSPRIAAGSSDGPISEH"
     MDLKQLSASL GLSPTTVSRA LNGYPEVSER TRERVIEAAK EVGYEPNVTA RRLARGAVDA        60
     IGIVHPTGAG HLDDPRFLEV VDGLTERFSK AGIDLLIASA RQKEEVATYK RLLQGRRVDG       120
     FIVHHTRRVD PRLDYLQECG APFVAYGRTD TPDSYAWFDF DNALGSSLAV RRLQEFGHRR       180
     IAYMHAPLEL HFAYQRYQGY LDAMHAAGLP VDPGLVVPAG FGRRGGYEAM KTLLDRAEGP       240
     TAVIVDNNLC GVGVLRCALD AGLKIGRQLS LIVYDGVPVD SVVTSVQVTS IEQPTSYAVG       300
     VQLAELMIGV LAGQPVQELQ TLWSPRIAAG SSDGPISEH                              339
//

If you have problems or comments...

PBIL Back to PBIL home page