(data stored in ACNUC7421 zone)

EMBL: CP000529.PE224

CP000529.PE224       Location/Qualifiers
FT   CDS             231975..233042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0226"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: ccr:CC1137
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35551"
FT                   /db_xref="GOA:A1VIS3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS3"
FT                   /protein_id="ABM35551.1"
FT                   /translation="MKRTQKTSSRSADDATEKGRPQMADLARLAGVSVATVSRALNGSA
FT                   LISKDTRERIEELARSLNYSINIGAKNLRLKQNRTIAVVIPYDRVSRQHISDPFFLAMV
FT                   GSLADAITERGFDMLLSRVDAESLDSAADLYNSGKAIGIILIGQWRHHDQLNQMAAKRM
FT                   PIVVWGTQIPQQLYCTVGGDNMAGGAMATRHLLERGYRRIVFIGDPQLAEVTYRHQGYV
FT                   EALAAYGLQPDPQLLVCVPFDANEARAGINRLCEQGVSFDAVFACSDVMASAASQVLHL
FT                   HGRTVPDAVGVVGYDDIEWASHCNPPLTTVRQPIGAAGAELVDALLCVIDGVVVVPRVL
FT                   PVELVVRSSTRPDPG"
     MKRTQKTSSR SADDATEKGR PQMADLARLA GVSVATVSRA LNGSALISKD TRERIEELAR        60
     SLNYSINIGA KNLRLKQNRT IAVVIPYDRV SRQHISDPFF LAMVGSLADA ITERGFDMLL       120
     SRVDAESLDS AADLYNSGKA IGIILIGQWR HHDQLNQMAA KRMPIVVWGT QIPQQLYCTV       180
     GGDNMAGGAM ATRHLLERGY RRIVFIGDPQ LAEVTYRHQG YVEALAAYGL QPDPQLLVCV       240
     PFDANEARAG INRLCEQGVS FDAVFACSDV MASAASQVLH LHGRTVPDAV GVVGYDDIEW       300
     ASHCNPPLTT VRQPIGAAGA ELVDALLCVI DGVVVVPRVL PVELVVRSST RPDPG            355
//

If you have problems or comments...

PBIL Back to PBIL home page