(data stored in ACNUC7421 zone)

EMBL: CP000529.PE23

CP000529.PE23        Location/Qualifiers
FT   CDS             21825..22331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_1824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35350"
FT                   /db_xref="InterPro:IPR022548"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI72"
FT                   /protein_id="ABM35350.1"
FT                   /translation="MNLQRLSGFSTPRNRHFTLWALALGCLLLSGCSATGAKFQGLEKP
FT                   DSDAGEIVVYRPDRLVRGGVAYYVHLDGKEVGMLKNAGFVALRTTPGTHVVLMKAGLQD
FT                   FFMKARTAEVVLLAGERKFLRFEPSITGSPIVLPNVAYVPVGFGFIAVPEGQAAIELRD
FT                   LNQSK"
     MNLQRLSGFS TPRNRHFTLW ALALGCLLLS GCSATGAKFQ GLEKPDSDAG EIVVYRPDRL        60
     VRGGVAYYVH LDGKEVGMLK NAGFVALRTT PGTHVVLMKA GLQDFFMKAR TAEVVLLAGE       120
     RKFLRFEPSI TGSPIVLPNV AYVPVGFGFI AVPEGQAAIE LRDLNQSK                    168
//

If you have problems or comments...

PBIL Back to PBIL home page