(data stored in ACNUC7421 zone)

EMBL: CP000529.PE230

CP000529.PE230       Location/Qualifiers
FT   CDS             238956..240437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0232"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: atc:AGR_pTi_251
FT                   sucrose phosphorylase SplA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35557"
FT                   /db_xref="GOA:A1VIS9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS9"
FT                   /protein_id="ABM35557.1"
FT                   /translation="MKNEVQLITYADRLSGGTLQDLRALLNGPLAGVFGAVHILPFFYS
FT                   IHGADAGFDPIDHTRVDPALGDWSDIKALAQDMDVMADVIVNHMSSDSPQFIDYSKRGA
FT                   ASPYNGLFLTFDAVFPEGATEEDLISVYRPRPGLPFTCMTLANGEKKILWTTFTPKQLD
FT                   IDVQHPQGRSYLESILQALASSGVKMIRLDAVGYAIKKQGDSCFLMPETFDFIDEFAAL
FT                   CRSVGLEVLVEVHSYYRKQIEIAKRVDWVYDFALPPLVLHAFFFKTGKHLKQWIAQRPT
FT                   NALTVLDTHDGIGIIDIGADPSDRVNRPGLVPPQELDRLVEIIHINSGGQSREATGAAA
FT                   SNLDLYQVNCTFYDAMGRDDTAYLLARAIQFFMPGIPQVYYVGLLAGRNDMDLLERTRV
FT                   GRDINRHRYASAEVDSALGRPVVQQLLELIRLRNAHPAFDGAFSVEPTGDSCLHMRWIN
FT                   GPVVAELLVDFTDLRHELLFTDEGGTRRIAFAKAF"
     MKNEVQLITY ADRLSGGTLQ DLRALLNGPL AGVFGAVHIL PFFYSIHGAD AGFDPIDHTR        60
     VDPALGDWSD IKALAQDMDV MADVIVNHMS SDSPQFIDYS KRGAASPYNG LFLTFDAVFP       120
     EGATEEDLIS VYRPRPGLPF TCMTLANGEK KILWTTFTPK QLDIDVQHPQ GRSYLESILQ       180
     ALASSGVKMI RLDAVGYAIK KQGDSCFLMP ETFDFIDEFA ALCRSVGLEV LVEVHSYYRK       240
     QIEIAKRVDW VYDFALPPLV LHAFFFKTGK HLKQWIAQRP TNALTVLDTH DGIGIIDIGA       300
     DPSDRVNRPG LVPPQELDRL VEIIHINSGG QSREATGAAA SNLDLYQVNC TFYDAMGRDD       360
     TAYLLARAIQ FFMPGIPQVY YVGLLAGRND MDLLERTRVG RDINRHRYAS AEVDSALGRP       420
     VVQQLLELIR LRNAHPAFDG AFSVEPTGDS CLHMRWINGP VVAELLVDFT DLRHELLFTD       480
     EGGTRRIAFA KAF                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page