(data stored in ACNUC7421 zone)

EMBL: CP000529.PE233

CP000529.PE233       Location/Qualifiers
FT   CDS             241592..242113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35560"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT2"
FT                   /protein_id="ABM35560.1"
FT                   /translation="MSRFLSFLTVLLALAACTPAFNWRDVHPEGTRLNLLLPCKPDTAH
FT                   KVVPLGGQPTTLAMLGCDAGGATFAVAVADVGDAARAASVLALWQELTLANMKAAPGSR
FT                   QPFALAIPGASAGVPVTRVQAQGQRADGTAVSGQAAYFAQGSQVFQVVMYAPQIAPEVA
FT                   DTFFSSLKFE"
     MSRFLSFLTV LLALAACTPA FNWRDVHPEG TRLNLLLPCK PDTAHKVVPL GGQPTTLAML        60
     GCDAGGATFA VAVADVGDAA RAASVLALWQ ELTLANMKAA PGSRQPFALA IPGASAGVPV       120
     TRVQAQGQRA DGTAVSGQAA YFAQGSQVFQ VVMYAPQIAP EVADTFFSSL KFE              173
//

If you have problems or comments...

PBIL Back to PBIL home page