(data stored in ACNUC7421 zone)

EMBL: CP000529.PE237

CP000529.PE237       Location/Qualifiers
FT   CDS             244239..246014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0239"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: pol:Bpro_0299
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35564"
FT                   /db_xref="GOA:A1VIT6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT6"
FT                   /protein_id="ABM35564.1"
FT                   /translation="MTFSVHGLAVSRGVAIGRAVLVASSRADVSHYFVDPATTDDEIAR
FT                   VRLSRNAVMEEITRLQHDLPRDAPHEIAALLDVHLMLLQDEMLIGGVKHWITERYYNAE
FT                   WALTTQYELIARQFDEMEDPYLRERKADLEQVVERVLCHMKGAASPLQAARQGAVRAGS
FT                   SRKQSQQDLLLDDTLDVPLVLVAHDISPADMLQFKQSLFAGFATDVGGKTSHTAIVARS
FT                   MDIPAVVGARSASQLIKQDDWVIIDGDAGVLIVDPSPIILAEYGFKQRQGELERLRLNR
FT                   LRHTPALTMDRQRIELLANIEMPDDTLGAVEAGAVGVGLFRSEFLFMGRAGKLPDENEQ
FT                   YLAYRKAIEGMQGMPVTIRTVDIGSDKPLDRPTAKAQDGHLNPALGLRAIRWSLADPPM
FT                   FLTQLRAILRAAAHGQVNLLVPMLAHASEIRQTLDLINQARAQLDARGFVYGPVRLGAM
FT                   IEVPAAALTVPVFLKYFDFLSIGTNDLTQYTLAIDRSDESVAHLYDPCHPAVLRLIADT
FT                   IAECNAQKKGVSVCGEMAGDVSMTRLLLGLGLRSFSMHPSQILAVKQQILRADTGKLKL
FT                   WAQEVLQSENPAALL"
     MTFSVHGLAV SRGVAIGRAV LVASSRADVS HYFVDPATTD DEIARVRLSR NAVMEEITRL        60
     QHDLPRDAPH EIAALLDVHL MLLQDEMLIG GVKHWITERY YNAEWALTTQ YELIARQFDE       120
     MEDPYLRERK ADLEQVVERV LCHMKGAASP LQAARQGAVR AGSSRKQSQQ DLLLDDTLDV       180
     PLVLVAHDIS PADMLQFKQS LFAGFATDVG GKTSHTAIVA RSMDIPAVVG ARSASQLIKQ       240
     DDWVIIDGDA GVLIVDPSPI ILAEYGFKQR QGELERLRLN RLRHTPALTM DRQRIELLAN       300
     IEMPDDTLGA VEAGAVGVGL FRSEFLFMGR AGKLPDENEQ YLAYRKAIEG MQGMPVTIRT       360
     VDIGSDKPLD RPTAKAQDGH LNPALGLRAI RWSLADPPMF LTQLRAILRA AAHGQVNLLV       420
     PMLAHASEIR QTLDLINQAR AQLDARGFVY GPVRLGAMIE VPAAALTVPV FLKYFDFLSI       480
     GTNDLTQYTL AIDRSDESVA HLYDPCHPAV LRLIADTIAE CNAQKKGVSV CGEMAGDVSM       540
     TRLLLGLGLR SFSMHPSQIL AVKQQILRAD TGKLKLWAQE VLQSENPAAL L                591
//

If you have problems or comments...

PBIL Back to PBIL home page