(data stored in ACNUC7421 zone)

EMBL: CP000529.PE240

CP000529.PE240       Location/Qualifiers
FT   CDS             complement(247458..248456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0242"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: pol:Bpro_0313 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35567"
FT                   /db_xref="GOA:A1VIT9"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIT9"
FT                   /protein_id="ABM35567.1"
FT                   /translation="MSTPEVVREVQSLETYNPLAKQKAAAKLSRIPVKVVQGEILKKPD
FT                   WIRVKAGSPSTRFYEIKQILRENKLNTVCEEASCPNIGECFGKGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDADEPLNLARTIAALKLKYVVITSVDRDDLRDGGSGHFVECIQRIR
FT                   ELSPGTTIEVLVPDFRGRDDRALEILKTSPPDVMNHNLETAPRLYKEARPGSDYQFSLN
FT                   LLKKFKALHPDVPTKSGIMVGLGETDEEILQVMQDMRDHGINMLTIGQYLAPSTSHLPV
FT                   RRYVHPDTFKMFEEKAYEMGFSHAAVGAMVRSSYHADQQAHAAGVSDKPAE"
     MSTPEVVREV QSLETYNPLA KQKAAAKLSR IPVKVVQGEI LKKPDWIRVK AGSPSTRFYE        60
     IKQILRENKL NTVCEEASCP NIGECFGKGT ATFMIMGDKC TRRCPFCDVG HGRPDPLDAD       120
     EPLNLARTIA ALKLKYVVIT SVDRDDLRDG GSGHFVECIQ RIRELSPGTT IEVLVPDFRG       180
     RDDRALEILK TSPPDVMNHN LETAPRLYKE ARPGSDYQFS LNLLKKFKAL HPDVPTKSGI       240
     MVGLGETDEE ILQVMQDMRD HGINMLTIGQ YLAPSTSHLP VRRYVHPDTF KMFEEKAYEM       300
     GFSHAAVGAM VRSSYHADQQ AHAAGVSDKP AE                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page