(data stored in ACNUC7421 zone)

EMBL: CP000529.PE241

CP000529.PE241       Location/Qualifiers
FT   CDS             complement(248496..249170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0243"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: pol:Bpro_0314
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35568"
FT                   /db_xref="GOA:A1VIU0"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIU0"
FT                   /protein_id="ABM35568.1"
FT                   /translation="MTIDTRQLGRVDYLPTYQAMQDFTAARNEATPDALWICEHPAVYT
FT                   QGLAGKIDHLLNPGEIPVVQTNRGGQVTFHGPGQVVVYPLIDLKRAGYFVKEYVYRIEE
FT                   SVIRTLAHFGVTGHRVAGSPGIYVRMDDPFSHAALSGPVHPSDPFRGLGKIAALGIKVS
FT                   RHCTYHGVALNVAMDLEPFSRINPCGYAGLKTTDLSTIGVSASWQEAASVLGQKLATYL
FT                   AP"
     MTIDTRQLGR VDYLPTYQAM QDFTAARNEA TPDALWICEH PAVYTQGLAG KIDHLLNPGE        60
     IPVVQTNRGG QVTFHGPGQV VVYPLIDLKR AGYFVKEYVY RIEESVIRTL AHFGVTGHRV       120
     AGSPGIYVRM DDPFSHAALS GPVHPSDPFR GLGKIAALGI KVSRHCTYHG VALNVAMDLE       180
     PFSRINPCGY AGLKTTDLST IGVSASWQEA ASVLGQKLAT YLAP                        224
//

If you have problems or comments...

PBIL Back to PBIL home page