(data stored in ACNUC7421 zone)

EMBL: CP000529.PE242

CP000529.PE242       Location/Qualifiers
FT   CDS             complement(249304..250065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0244"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: SEC-C motif
FT                   domain protein; KEGG: xcv:XCVb0013 putative metal-binding
FT                   protein, sec-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35569"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU1"
FT                   /protein_id="ABM35569.1"
FT                   /translation="MNDFFDYNLRHPLPQQSPRLTEADHDELFKLFGDASLPAATMPAE
FT                   MADGYLTACVVGPVPVPAHEWMEAIFGQPTLPVCADPERQHRLLQLLLQRHRDIAVATA
FT                   VALHDLTPDQLFVPLTSEVDAGERITPYQIDENGNRQGDWDCKDWAEGFRLAMLDHPQW
FT                   DGLTNNPKNFDLLAPIALFAEGYNPDQPELQIDEKANLPALLSLSIYNIRSFWKLHKQT
FT                   HAPALREARKVGRNDPCPCGSGKKYKKCCGA"
     MNDFFDYNLR HPLPQQSPRL TEADHDELFK LFGDASLPAA TMPAEMADGY LTACVVGPVP        60
     VPAHEWMEAI FGQPTLPVCA DPERQHRLLQ LLLQRHRDIA VATAVALHDL TPDQLFVPLT       120
     SEVDAGERIT PYQIDENGNR QGDWDCKDWA EGFRLAMLDH PQWDGLTNNP KNFDLLAPIA       180
     LFAEGYNPDQ PELQIDEKAN LPALLSLSIY NIRSFWKLHK QTHAPALREA RKVGRNDPCP       240
     CGSGKKYKKC CGA                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page