(data stored in ACNUC7421 zone)

EMBL: CP000529.PE243

CP000529.PE243       Location/Qualifiers
FT   CDS             complement(250139..250450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0245"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   pol:Bpro_0316 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35570"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU2"
FT                   /protein_id="ABM35570.1"
FT                   /translation="MSADNDNTPPNPPEAEARKDSLIEYPSLFPIKVMGIKAEGYVHAI
FT                   THIAHQFDPTFDAATIELRESKGGKYLGVTITVTATSREQLDELYRTLSTHPMVKVVL"
     MSADNDNTPP NPPEAEARKD SLIEYPSLFP IKVMGIKAEG YVHAITHIAH QFDPTFDAAT        60
     IELRESKGGK YLGVTITVTA TSREQLDELY RTLSTHPMVK VVL                         103
//

If you have problems or comments...

PBIL Back to PBIL home page