(data stored in ACNUC7421 zone)

EMBL: CP000529.PE244

CP000529.PE244       Location/Qualifiers
FT   CDS             complement(250453..251364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0246"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class IV; KEGG:
FT                   pol:Bpro_0317 aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35571"
FT                   /db_xref="GOA:A1VIU3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU3"
FT                   /protein_id="ABM35571.1"
FT                   /translation="MQSTSMTTSAASALPDTPCYLNGDFSTLRDAKISVLDRGFIFGDA
FT                   VYEVVPAYAGKLFRFEQHMARLDRSLAELRIANPLTHAQWQGITLKLIADHALSTGTET
FT                   QKDNQLIYIQVTRGVAMRDHPMLPGLTPTVFIMVNPMKLPSDQQRAQGVACVSAGDFRW
FT                   EKAHIKSTSLLGAVFSRQISVDAGALETVMFRGDHLSEAAASNVWVVKHGKVMGPPRDH
FT                   LVLEGIRYGLIEEICRAAGIDFELCRISRAEVLAADELLLSSATKEILPITLLDGQPVG
FT                   NGQPGPIYAKLYAAYQQAKEES"
     MQSTSMTTSA ASALPDTPCY LNGDFSTLRD AKISVLDRGF IFGDAVYEVV PAYAGKLFRF        60
     EQHMARLDRS LAELRIANPL THAQWQGITL KLIADHALST GTETQKDNQL IYIQVTRGVA       120
     MRDHPMLPGL TPTVFIMVNP MKLPSDQQRA QGVACVSAGD FRWEKAHIKS TSLLGAVFSR       180
     QISVDAGALE TVMFRGDHLS EAAASNVWVV KHGKVMGPPR DHLVLEGIRY GLIEEICRAA       240
     GIDFELCRIS RAEVLAADEL LLSSATKEIL PITLLDGQPV GNGQPGPIYA KLYAAYQQAK       300
     EES                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page