(data stored in ACNUC7421 zone)

EMBL: CP000529.PE247

CP000529.PE247       Location/Qualifiers
FT   CDS             252735..253628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0249"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   rfr:Rfer_0112 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35574"
FT                   /db_xref="GOA:A1VIU6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU6"
FT                   /protein_id="ABM35574.1"
FT                   /translation="MAAAEHAGTTGPTSGEYIQHHLHHLQKNFSFENVEQHSIVDFSLF
FT                   NFDSLLYSVLLGVIGCFFLWRAASKATSGVPGRFQAAVEILSELVDNQAKGVIHNAKSR
FT                   KLVSPLALTVFVWIFLMNAMDMLPVDAIPSLWHDAGPALGFNNFMRVVPTADVSTTLGL
FT                   SSSVLLVCLVYNIKIKGLGGWAHELIAAPFGDHWFLYPINFLMQMIEFAAKTMSHGMRL
FT                   FGNMFAGELVFMLIALMGGTWAWQFNPLTGMFWLGFGHVVAGTVWSIFHILVITLQAFI
FT                   FMMLTLIYVGQAHDSH"
     MAAAEHAGTT GPTSGEYIQH HLHHLQKNFS FENVEQHSIV DFSLFNFDSL LYSVLLGVIG        60
     CFFLWRAASK ATSGVPGRFQ AAVEILSELV DNQAKGVIHN AKSRKLVSPL ALTVFVWIFL       120
     MNAMDMLPVD AIPSLWHDAG PALGFNNFMR VVPTADVSTT LGLSSSVLLV CLVYNIKIKG       180
     LGGWAHELIA APFGDHWFLY PINFLMQMIE FAAKTMSHGM RLFGNMFAGE LVFMLIALMG       240
     GTWAWQFNPL TGMFWLGFGH VVAGTVWSIF HILVITLQAF IFMMLTLIYV GQAHDSH          297
//

If you have problems or comments...

PBIL Back to PBIL home page