(data stored in ACNUC7421 zone)

EMBL: CP000529.PE248

CP000529.PE248       Location/Qualifiers
FT   CDS             253702..253950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0250"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   rfr:Rfer_0111 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35575"
FT                   /db_xref="GOA:A1VIU7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU7"
FT                   /protein_id="ABM35575.1"
FT                   /translation="MENILGLVALACGLIVGLGAIGASIGIALMGGKFLEASARQPELM
FT                   NDLQTKMFILAGLIDAAFLIGVAIALLFAFANPFVLR"
     MENILGLVAL ACGLIVGLGA IGASIGIALM GGKFLEASAR QPELMNDLQT KMFILAGLID        60
     AAFLIGVAIA LLFAFANPFV LR                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page