(data stored in ACNUC7421 zone)

EMBL: CP000529.PE249

CP000529.PE249       Location/Qualifiers
FT   CDS             253991..254461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0251"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   rfr:Rfer_0110 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35576"
FT                   /db_xref="GOA:A1VIU8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIU8"
FT                   /protein_id="ABM35576.1"
FT                   /translation="MNINSTLFLQAVVFAILVWFTMKFVWPPITKALDERAQKIADGLA
FT                   AADKAKSELSSANKRVEAELATSRTETATRLADADRRGQGIIEDAKARAVEEANKIIAA
FT                   AQAEAAQQSVKAREALREQVALLAVKGAEQILRKEVNAGVHADLLSRLKTEL"
     MNINSTLFLQ AVVFAILVWF TMKFVWPPIT KALDERAQKI ADGLAAADKA KSELSSANKR        60
     VEAELATSRT ETATRLADAD RRGQGIIEDA KARAVEEANK IIAAAQAEAA QQSVKAREAL       120
     REQVALLAVK GAEQILRKEV NAGVHADLLS RLKTEL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page