(data stored in ACNUC7421 zone)

EMBL: CP000529.PE250

CP000529.PE250       Location/Qualifiers
FT   CDS             254483..255022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0252"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: pol:Bpro_0324 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35577"
FT                   /db_xref="GOA:A1VIU9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIU9"
FT                   /protein_id="ABM35577.1"
FT                   /translation="MAELATIARPYADALYKAQGSDLATTALWVDKLAAVAGNAQLLQF
FT                   ADSPKVSVDQVFDVVAGVASNANDPLPEAARNFLRLVIENGRLSALPEIASQFRSLKNA
FT                   AGGMTDAVVFSAFPMDEQALNDIAAVLEKRFGRKLGIKVELDPSLIGGIRAVVGDEVLD
FT                   TSVKARLEQMKMALIA"
     MAELATIARP YADALYKAQG SDLATTALWV DKLAAVAGNA QLLQFADSPK VSVDQVFDVV        60
     AGVASNANDP LPEAARNFLR LVIENGRLSA LPEIASQFRS LKNAAGGMTD AVVFSAFPMD       120
     EQALNDIAAV LEKRFGRKLG IKVELDPSLI GGIRAVVGDE VLDTSVKARL EQMKMALIA        179
//

If you have problems or comments...

PBIL Back to PBIL home page