(data stored in ACNUC7421 zone)

EMBL: CP000529.PE252

CP000529.PE252       Location/Qualifiers
FT   CDS             256691..257557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0254"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0326 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35579"
FT                   /db_xref="GOA:A1VIV1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIV1"
FT                   /protein_id="ABM35579.1"
FT                   /translation="MAAGKEIRGKIKSVENTRKITKAMEMVAASKMRKAQERMRAARPY
FT                   SDKIRNIAAHLSQANPEYTHPFMESNDAKTTGFIVVTTDKGLCGGLNTNVLRLLTTKLK
FT                   DMQAAGEDAQAVAIGNKGLGFLNRIGVKVAAHATQLGDKPHLDKLIGPVKVLLDAYSEG
FT                   KIKAVYLCYTRFINTMKQESVVEQLLPLTADRMQPDKTEHSWDYIYEPDAQTVIDELLV
FT                   RYVEALVFQAVAENMASEQSARMVAMKSATDNAGSVIGELKLIYNKTRQAAITKELSEI
FT                   VAGAAAV"
     MAAGKEIRGK IKSVENTRKI TKAMEMVAAS KMRKAQERMR AARPYSDKIR NIAAHLSQAN        60
     PEYTHPFMES NDAKTTGFIV VTTDKGLCGG LNTNVLRLLT TKLKDMQAAG EDAQAVAIGN       120
     KGLGFLNRIG VKVAAHATQL GDKPHLDKLI GPVKVLLDAY SEGKIKAVYL CYTRFINTMK       180
     QESVVEQLLP LTADRMQPDK TEHSWDYIYE PDAQTVIDEL LVRYVEALVF QAVAENMASE       240
     QSARMVAMKS ATDNAGSVIG ELKLIYNKTR QAAITKELSE IVAGAAAV                    288
//

If you have problems or comments...

PBIL Back to PBIL home page