(data stored in ACNUC7421 zone)

EMBL: CP000529.PE259

CP000529.PE259       Location/Qualifiers
FT   CDS             262290..263309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0261"
FT                   /product="hydrolase of the alpha/beta-hydrolase fold-like
FT                   protein"
FT                   /note="KEGG: pol:Bpro_0334 hydrolase of the
FT                   alpha/beta-hydrolase fold-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35586"
FT                   /db_xref="GOA:A1VIV8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV8"
FT                   /protein_id="ABM35586.1"
FT                   /translation="MAMNYGAPWWLPDGNTQTIWAALRARRFMGPPPVFRRERWSTPDD
FT                   DFVDVDWLMPRFESAGLAERGAVREAPSVGVPLLVLFHGLEGSSSSHYAQAFADVAGSR
FT                   GWACAVPHFRGCSGEPNLAPRAYHSGDFAEIDWMLRRFAGLNQGPVVAVGISLGGNALM
FT                   RWAGEMGTQAGQVVTAVAAVCAPLDLTASGQAIGQGFNRQVYTRMFLKSMVPKALQKLA
FT                   QHPGLFDRDTLLAARDLHAFDNVFTGPVHGFKGVDDYWSRASAKPHLGRIAVPALALNA
FT                   LNDPFIPAASLPQSADVSPWVTLWQPAQGGHVGFPASNFPAHVRAMPEAVAGFLAAQL"
     MAMNYGAPWW LPDGNTQTIW AALRARRFMG PPPVFRRERW STPDDDFVDV DWLMPRFESA        60
     GLAERGAVRE APSVGVPLLV LFHGLEGSSS SHYAQAFADV AGSRGWACAV PHFRGCSGEP       120
     NLAPRAYHSG DFAEIDWMLR RFAGLNQGPV VAVGISLGGN ALMRWAGEMG TQAGQVVTAV       180
     AAVCAPLDLT ASGQAIGQGF NRQVYTRMFL KSMVPKALQK LAQHPGLFDR DTLLAARDLH       240
     AFDNVFTGPV HGFKGVDDYW SRASAKPHLG RIAVPALALN ALNDPFIPAA SLPQSADVSP       300
     WVTLWQPAQG GHVGFPASNF PAHVRAMPEA VAGFLAAQL                              339
//

If you have problems or comments...

PBIL Back to PBIL home page