(data stored in ACNUC7421 zone)

EMBL: CP000529.PE260

CP000529.PE260       Location/Qualifiers
FT   CDS             263367..263927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35587"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV9"
FT                   /protein_id="ABM35587.1"
FT                   /translation="MDDIVKQAIAKWPNVPDCYGWLGLDARGNWYMRDDRAQSAGPFAL
FT                   VGDADRHAASKGSLLKHDKLIDFIQRNYESDASGRWFFQNGPQRVYVELEATPFIWRVH
FT                   AAAGFSVTAHTGQPARVQRCVLDEDGRLYLETDLGFGLVHTQDMMYAADAVEQGLWVPQ
FT                   EFPAADLPARFGYVRTPRALQNT"
     MDDIVKQAIA KWPNVPDCYG WLGLDARGNW YMRDDRAQSA GPFALVGDAD RHAASKGSLL        60
     KHDKLIDFIQ RNYESDASGR WFFQNGPQRV YVELEATPFI WRVHAAAGFS VTAHTGQPAR       120
     VQRCVLDEDG RLYLETDLGF GLVHTQDMMY AADAVEQGLW VPQEFPAADL PARFGYVRTP       180
     RALQNT                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page