(data stored in ACNUC7421 zone)

EMBL: CP000529.PE263

CP000529.PE263       Location/Qualifiers
FT   CDS             266396..267367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0265"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0596 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35590"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW2"
FT                   /protein_id="ABM35590.1"
FT                   /translation="MKRHFLRTIPALIALSVSPLFAAAQAAWPAKPITLVSPYAPGGTT
FT                   DLLARLLASKLQGVLGQTVIVENKGGAGGNIGTDYVSKSKPDGYTFLVASSGPLVIAPS
FT                   LYPKLPYQPNLDFTPVAPLASAAFVIAVNPGSGLTSVKDIIAKAKAGNLSFASAGSGTP
FT                   QHIIGEMFNVQAGVKIQHIPYKGSGPAMNDLVGGQVPMTFENPVPIMPQVKAGKLKVLA
FT                   VTSAKRSAAFPDIPTVSELGLKGFDAQPWYGVLGPAGVPAEVVERMNKEIRTILASTDV
FT                   KARLFALGAEPMDMTPSAFKSFIAADTKKWTAVVKASGATVD"
     MKRHFLRTIP ALIALSVSPL FAAAQAAWPA KPITLVSPYA PGGTTDLLAR LLASKLQGVL        60
     GQTVIVENKG GAGGNIGTDY VSKSKPDGYT FLVASSGPLV IAPSLYPKLP YQPNLDFTPV       120
     APLASAAFVI AVNPGSGLTS VKDIIAKAKA GNLSFASAGS GTPQHIIGEM FNVQAGVKIQ       180
     HIPYKGSGPA MNDLVGGQVP MTFENPVPIM PQVKAGKLKV LAVTSAKRSA AFPDIPTVSE       240
     LGLKGFDAQP WYGVLGPAGV PAEVVERMNK EIRTILASTD VKARLFALGA EPMDMTPSAF       300
     KSFIAADTKK WTAVVKASGA TVD                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page