(data stored in ACNUC7421 zone)

EMBL: CP000529.PE269

CP000529.PE269       Location/Qualifiers
FT   CDS             272329..272790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0271"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   pol:Bpro_0391 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35596"
FT                   /db_xref="GOA:A1VIW8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIW8"
FT                   /protein_id="ABM35596.1"
FT                   /translation="MWFSRKQAVNVAPKSTAGGAAALPKQVTTKSRGDAAESAARAYLV
FT                   GAGLRWIESNYRTPGRGGGEIDLVMRVPDGTLVFVEVRQRSSASHGGAGASISAVKQRR
FT                   IIFAARHYLMRFASLPPCRFDVVLVHGALSGGESPQATIEWLPAAFDAS"
     MWFSRKQAVN VAPKSTAGGA AALPKQVTTK SRGDAAESAA RAYLVGAGLR WIESNYRTPG        60
     RGGGEIDLVM RVPDGTLVFV EVRQRSSASH GGAGASISAV KQRRIIFAAR HYLMRFASLP       120
     PCRFDVVLVH GALSGGESPQ ATIEWLPAAF DAS                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page