(data stored in ACNUC7421 zone)

EMBL: CP000529.PE271

CP000529.PE271       Location/Qualifiers
FT   CDS             273499..274164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0273"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region, bacteria; KEGG:
FT                   pol:Bpro_0393 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35598"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX0"
FT                   /protein_id="ABM35598.1"
FT                   /translation="MNHGVMKRLACSVGAAVLLTGALSACVGPLIVGGAMVGGSMVATD
FT                   RRTSGAQLDDEAIELRAASQIRSNLGTRVRVSVTSYNRQVLLTGEVPNLQDKQRVEQVV
FT                   KAVDSVASVVNELAVLNSPSLMDRSSDALLTGRIKAMLLDTSDLQSNAFKVVTERNTTY
FT                   LMGRVTQREADRATEVVRATPGVQKVVRIFEIISEQELKNMDTVPSGMQPAAPKPAGV"
     MNHGVMKRLA CSVGAAVLLT GALSACVGPL IVGGAMVGGS MVATDRRTSG AQLDDEAIEL        60
     RAASQIRSNL GTRVRVSVTS YNRQVLLTGE VPNLQDKQRV EQVVKAVDSV ASVVNELAVL       120
     NSPSLMDRSS DALLTGRIKA MLLDTSDLQS NAFKVVTERN TTYLMGRVTQ READRATEVV       180
     RATPGVQKVV RIFEIISEQE LKNMDTVPSG MQPAAPKPAG V                           221
//

If you have problems or comments...

PBIL Back to PBIL home page