(data stored in ACNUC7421 zone)

EMBL: CP000529.PE275

CP000529.PE275       Location/Qualifiers
FT   CDS             complement(278104..279147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0278"
FT                   /product="pilus retraction ATPase PilT"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: pol:Bpro_0396 twitching
FT                   motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35602"
FT                   /db_xref="GOA:A1VIX4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX4"
FT                   /protein_id="ABM35602.1"
FT                   /translation="MDITQLLAFSVKNKASDLHLSAGLPPMIRVHGDVRRINIDPLDHK
FT                   EVHAMVYDIMNDTQRKHYEEFLEVDFSFEIDGLARFRVNAFNHNRGAGAVLRTIPSKIL
FT                   TLEQLGCPKIFGDLALKPRGMVLVTGPTGSGKSTTLAAMVNYLNETEYGHILTVEDPIE
FT                   FVHESKKCLINQREVGPHTLSFSAALKSALREDPDAILVGEMRDLETIRLAMTAAETGH
FT                   LVFGTLHTSSAAKTIDRIIDVFPAEEKEMIRSMLSESLQAVISQTLCKTKDGQGRVAAH
FT                   EIMLGTSAIRNLIREAKVAQMYSSIQTGNSVGMQTLDQNLTDLVKRNVISSAEARGKAK
FT                   IPDNFPG"
     MDITQLLAFS VKNKASDLHL SAGLPPMIRV HGDVRRINID PLDHKEVHAM VYDIMNDTQR        60
     KHYEEFLEVD FSFEIDGLAR FRVNAFNHNR GAGAVLRTIP SKILTLEQLG CPKIFGDLAL       120
     KPRGMVLVTG PTGSGKSTTL AAMVNYLNET EYGHILTVED PIEFVHESKK CLINQREVGP       180
     HTLSFSAALK SALREDPDAI LVGEMRDLET IRLAMTAAET GHLVFGTLHT SSAAKTIDRI       240
     IDVFPAEEKE MIRSMLSESL QAVISQTLCK TKDGQGRVAA HEIMLGTSAI RNLIREAKVA       300
     QMYSSIQTGN SVGMQTLDQN LTDLVKRNVI SSAEARGKAK IPDNFPG                     347
//

If you have problems or comments...

PBIL Back to PBIL home page