(data stored in ACNUC7421 zone)

EMBL: CP000529.PE278

CP000529.PE278       Location/Qualifiers
FT   CDS             complement(281293..283803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0281"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: pol:Bpro_0428 diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35605"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX7"
FT                   /protein_id="ABM35605.1"
FT                   /translation="MPPGFIPGRPALTGGQVPTALQQAGHRLAMTERIAHIGSWALDLP
FT                   ALQLLTYSSEFAAILGLPADAPLTWDELADRFAPEYRKRIAALLQQCASHGTAFDEEMQ
FT                   IDTPLCRKWVRMACEAVQNKRGQIKSLQGVLQDISTQKHAQQETLHLAMRLTTTLASIT
FT                   EAFVTLDRQCCFTYLNQKSEQLLRHTTGELLGKEIWLVLVTDKNQRLRQELQRSIATNR
FT                   QLEFEDFYPGLGKWLEVRAYPFAEGLAVYFRDVSKRRKSQEQLMLLETCISRLNDIVLI
FT                   AEAQSGSPKVPYIVFVNQAFEEHTGYSGHEVLGQTPRKLFGPGAVQDELQGMTKMLLRK
FT                   RHARSELLIYRKNGSCFWLELEIVQVAVTADELTHWVAVGRDITQRKVNADAIHQLAFY
FT                   DPLTTLPNRLMLLNRLEQVMAQSAHPRRQGALMFIDVDKLKVLNDTLGHHKGDLLLQQV
FT                   AERLAGCVEDTDMVARLGGDEFVVLLENLGDDAGSAAAHARQLAEKVLEQLREPFDLGG
FT                   HQHYTTSSIGVTSLNAAHGSVSEVLKQADLAMYQAKTTGRNALCFFDPEMQAAVNANAA
FT                   VSSELHIALRKQEFVLHYQPQVDSQGRVNGVEALLRWHHPKRGLVMPTDFIPMAEETGL
FT                   ILPLGRWALATACEQLAAWAAWPQAADLSIAVNVSVRQFRHPDFVDQVMAEIRRTGIKP
FT                   QHLKLELTETLLADGMDVTLARMGTLKALGVTLALDDFGMGYSSLSLLKRLPLDQLKID
FT                   KSFVAEVLTDPADAAISRTIITLAHSLNLKVVAEGVETQAQQDFLVAEGCDQFQGFLFS
FT                   APLPIEALEAYLMAQSPPLKLQTA"
     MPPGFIPGRP ALTGGQVPTA LQQAGHRLAM TERIAHIGSW ALDLPALQLL TYSSEFAAIL        60
     GLPADAPLTW DELADRFAPE YRKRIAALLQ QCASHGTAFD EEMQIDTPLC RKWVRMACEA       120
     VQNKRGQIKS LQGVLQDIST QKHAQQETLH LAMRLTTTLA SITEAFVTLD RQCCFTYLNQ       180
     KSEQLLRHTT GELLGKEIWL VLVTDKNQRL RQELQRSIAT NRQLEFEDFY PGLGKWLEVR       240
     AYPFAEGLAV YFRDVSKRRK SQEQLMLLET CISRLNDIVL IAEAQSGSPK VPYIVFVNQA       300
     FEEHTGYSGH EVLGQTPRKL FGPGAVQDEL QGMTKMLLRK RHARSELLIY RKNGSCFWLE       360
     LEIVQVAVTA DELTHWVAVG RDITQRKVNA DAIHQLAFYD PLTTLPNRLM LLNRLEQVMA       420
     QSAHPRRQGA LMFIDVDKLK VLNDTLGHHK GDLLLQQVAE RLAGCVEDTD MVARLGGDEF       480
     VVLLENLGDD AGSAAAHARQ LAEKVLEQLR EPFDLGGHQH YTTSSIGVTS LNAAHGSVSE       540
     VLKQADLAMY QAKTTGRNAL CFFDPEMQAA VNANAAVSSE LHIALRKQEF VLHYQPQVDS       600
     QGRVNGVEAL LRWHHPKRGL VMPTDFIPMA EETGLILPLG RWALATACEQ LAAWAAWPQA       660
     ADLSIAVNVS VRQFRHPDFV DQVMAEIRRT GIKPQHLKLE LTETLLADGM DVTLARMGTL       720
     KALGVTLALD DFGMGYSSLS LLKRLPLDQL KIDKSFVAEV LTDPADAAIS RTIITLAHSL       780
     NLKVVAEGVE TQAQQDFLVA EGCDQFQGFL FSAPLPIEAL EAYLMAQSPP LKLQTA           836
//

If you have problems or comments...

PBIL Back to PBIL home page