(data stored in ACNUC7421 zone)

EMBL: CP000529.PE280

CP000529.PE280       Location/Qualifiers
FT   CDS             285312..285641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35607"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX9"
FT                   /protein_id="ABM35607.1"
FT                   /translation="MSALDGLRHCPDVATLKPALHRLCETFGRVARLDVLTAVHEGTRQ
FT                   AICFLRLDSPEQEQALMQTLGVGRFGGEIVFVVDLNSAVDKEVQGPSSQWVEFDSPRSC
FT                   ARPGL"
     MSALDGLRHC PDVATLKPAL HRLCETFGRV ARLDVLTAVH EGTRQAICFL RLDSPEQEQA        60
     LMQTLGVGRF GGEIVFVVDL NSAVDKEVQG PSSQWVEFDS PRSCARPGL                   109
//

If you have problems or comments...

PBIL Back to PBIL home page