(data stored in ACNUC7421 zone)

EMBL: CP000529.PE282

CP000529.PE282       Location/Qualifiers
FT   CDS             287118..288161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35609"
FT                   /db_xref="GOA:A1VIY1"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY1"
FT                   /protein_id="ABM35609.1"
FT                   /translation="MTVVYAINYITFALVCMLLMLLPFLPAFREWRHPSDAAALPVSPD
FT                   YSSDIDYFARRLQADVAARLGKGPATGYSDFDFVRVPVENMNWLKASKRLISARGIKSP
FT                   MPVRTIQPLYVLGSIHAGAESSFSVLYATGNIELDKKSEIHDWAHADGVVRLGHKSLAL
FT                   RRISAGMAIELGEEAWFERLQAPVLYFGSRTSHALPPVQADQTPASFADLPGAVRQTPS
FT                   LFLIRGDCELPAGNIYCGSLIVTGFLTVGERTTITGDIKSREGISIGQGAWVQGAITCE
FT                   KRVYVFKDARVAGPLISERDILIGANALIGQPDANTSVSARNIIVENGVVVHGAIWAHE
FT                   IGMVKSI"
     MTVVYAINYI TFALVCMLLM LLPFLPAFRE WRHPSDAAAL PVSPDYSSDI DYFARRLQAD        60
     VAARLGKGPA TGYSDFDFVR VPVENMNWLK ASKRLISARG IKSPMPVRTI QPLYVLGSIH       120
     AGAESSFSVL YATGNIELDK KSEIHDWAHA DGVVRLGHKS LALRRISAGM AIELGEEAWF       180
     ERLQAPVLYF GSRTSHALPP VQADQTPASF ADLPGAVRQT PSLFLIRGDC ELPAGNIYCG       240
     SLIVTGFLTV GERTTITGDI KSREGISIGQ GAWVQGAITC EKRVYVFKDA RVAGPLISER       300
     DILIGANALI GQPDANTSVS ARNIIVENGV VVHGAIWAHE IGMVKSI                     347
//

If you have problems or comments...

PBIL Back to PBIL home page