(data stored in ACNUC7421 zone)

EMBL: CP000529.PE285

CP000529.PE285       Location/Qualifiers
FT   CDS             290079..290918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35612"
FT                   /db_xref="GOA:A1VIY4"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY4"
FT                   /protein_id="ABM35612.1"
FT                   /translation="MRAATHSIAEQAREHNRIVHKAFTAARQIRERHVKVRPHRAITPL
FT                   KVTPYLLAQTVMLPLAILGLLILTKPFLLDFWRACLIFWSRGLDLPFTIATQLNRAGQY
FT                   AVRLSGGPDNAPMPSTTNLLVTTAVTLAVVVLSLRMKDAKQPLKYPLWILCFVQSTSLI
FT                   YFWLTPWSFPYSIALHCEELMTIGFIVMLATPFMLAMGYYILNLRLSIKIFHTVLILLF
FT                   MAVLVPHQVLAQALIMQEFSVLFMPVLYICFGAVFDALVFVALYSWAVSNVPENATV"
     MRAATHSIAE QAREHNRIVH KAFTAARQIR ERHVKVRPHR AITPLKVTPY LLAQTVMLPL        60
     AILGLLILTK PFLLDFWRAC LIFWSRGLDL PFTIATQLNR AGQYAVRLSG GPDNAPMPST       120
     TNLLVTTAVT LAVVVLSLRM KDAKQPLKYP LWILCFVQST SLIYFWLTPW SFPYSIALHC       180
     EELMTIGFIV MLATPFMLAM GYYILNLRLS IKIFHTVLIL LFMAVLVPHQ VLAQALIMQE       240
     FSVLFMPVLY ICFGAVFDAL VFVALYSWAV SNVPENATV                              279
//

If you have problems or comments...

PBIL Back to PBIL home page