(data stored in ACNUC7421 zone)

EMBL: CP000529.PE286

CP000529.PE286       Location/Qualifiers
FT   CDS             291076..291633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0290"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   pol:Bpro_0430 protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35613"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY5"
FT                   /protein_id="ABM35613.1"
FT                   /translation="MATPFFGKRDNEIPSSGVRPGSVNSYTGSGSSPSATLHPASPQGV
FT                   VKPLGSEPAASAGHERESGSKLTVGPNIKLKGVEITDCDTLVVEGTVEATMSSRVIQIA
FT                   EQGTFKGSAEIEIAEIRGEFNGNLTVRQKLVIYATGKVTGTIRYGKLVVEEGGQLSGEI
FT                   VFGTQGASSKPALMAKPGLQAA"
     MATPFFGKRD NEIPSSGVRP GSVNSYTGSG SSPSATLHPA SPQGVVKPLG SEPAASAGHE        60
     RESGSKLTVG PNIKLKGVEI TDCDTLVVEG TVEATMSSRV IQIAEQGTFK GSAEIEIAEI       120
     RGEFNGNLTV RQKLVIYATG KVTGTIRYGK LVVEEGGQLS GEIVFGTQGA SSKPALMAKP       180
     GLQAA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page