(data stored in ACNUC7421 zone)

EMBL: CP000529.PE289

CP000529.PE289       Location/Qualifiers
FT   CDS             complement(292879..294381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0293"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0433 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35616"
FT                   /db_xref="GOA:A1VIY8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY8"
FT                   /protein_id="ABM35616.1"
FT                   /translation="MNAPASPQQLSSLERAERQSQVVRALEAVLPGHALLWNREDTTPY
FT                   ECDGLTAYRERPLVVALPETYAEVQAVLKACHALDVPVVARGAGTGLSGGAMPHTLGVT
FT                   LSLAKFNKILKVDAASRTAVVQGGVRNLAISEAASPFGLYYAPDPSSQIACTIGGNVAE
FT                   NSGGVHCLKYGLTVHNVLKVKGFTIEGDEVEFGSDALDSAGYDLLAIVIGSEGMLAVTT
FT                   EVTVRLIPKPLLARCIMASFDDLRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVH
FT                   AGYDLSAAAILLCESDGTPEEVEEEIGRMSAVLERHGATAIAVSQNEAERLRFWSGRKN
FT                   AFPASGRISPDYMCMDSTIPRKRLADILLAIGEMEIKYGLRCANVFHAGDGNLHPLIMF
FT                   DANDADQLHRCELFGADILETSVAMGGTVTGEHGVGVEKLNSMCVQFSAAENEQMFGVK
FT                   RAFDPKGLLNPGKVIPTLHRCAEYGKMLVRGGKISHPDLPRF"
     MNAPASPQQL SSLERAERQS QVVRALEAVL PGHALLWNRE DTTPYECDGL TAYRERPLVV        60
     ALPETYAEVQ AVLKACHALD VPVVARGAGT GLSGGAMPHT LGVTLSLAKF NKILKVDAAS       120
     RTAVVQGGVR NLAISEAASP FGLYYAPDPS SQIACTIGGN VAENSGGVHC LKYGLTVHNV       180
     LKVKGFTIEG DEVEFGSDAL DSAGYDLLAI VIGSEGMLAV TTEVTVRLIP KPLLARCIMA       240
     SFDDLRKAGD AVAAVIAAGI IPAGLEMMDK PMTAAVEDFV HAGYDLSAAA ILLCESDGTP       300
     EEVEEEIGRM SAVLERHGAT AIAVSQNEAE RLRFWSGRKN AFPASGRISP DYMCMDSTIP       360
     RKRLADILLA IGEMEIKYGL RCANVFHAGD GNLHPLIMFD ANDADQLHRC ELFGADILET       420
     SVAMGGTVTG EHGVGVEKLN SMCVQFSAAE NEQMFGVKRA FDPKGLLNPG KVIPTLHRCA       480
     EYGKMLVRGG KISHPDLPRF                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page