(data stored in ACNUC7421 zone)

EMBL: CP000529.PE296

CP000529.PE296       Location/Qualifiers
FT   CDS             complement(299880..300161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35623"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ5"
FT                   /protein_id="ABM35623.1"
FT                   /translation="MQLLYDSDSFVVVQIHANAPEACAPQPAVPQLARHGFEIVDKRSG
FT                   KEVYLDGSWAEMFQQRLSAWARDTPTQEEVEDTLEGYSGLAMTPVSLH"
     MQLLYDSDSF VVVQIHANAP EACAPQPAVP QLARHGFEIV DKRSGKEVYL DGSWAEMFQQ        60
     RLSAWARDTP TQEEVEDTLE GYSGLAMTPV SLH                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page