(data stored in ACNUC7421 zone)

EMBL: CP000529.PE299

CP000529.PE299       Location/Qualifiers
FT   CDS             complement(302530..304749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35626"
FT                   /db_xref="GOA:A1VIZ8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ8"
FT                   /protein_id="ABM35626.1"
FT                   /translation="MFATIRRSGSGIFRWLYGAILIFAMGAAQAQNLSKMALLLPDGLA
FT                   VNDVQVTAWTDAAQEQGYQMSILRNADFLLLGAGARTQYSGIIVPDQIQVSMSDALVAT
FT                   IQSYVTQGGNIMLVYDAGALTANGFYAIPKSRFSDLVGVDYVLYDSLLDRTVGLGPVIG
FT                   LESTLRALHIPPGKSIPYTQTATTVTALADTPRAIQVADNGKKAPAGKATADFLPASPA
FT                   NPGGLKGYDHAQYFKSEPGVTEGSKERAKKLKQKIIDNKGKKNEKAIQREAVPGVTPNK
FT                   LSKDALRNLSTSSRIGNPSLGAKRYLTQASPPATDPVHAISGYVYGALTYPSFVTQGTA
FT                   LGATLMSSPDHGLVASSRTVGTGSVLFVNLPLTYLKLYEDSMPMHGFLHLFARGPAKQP
FT                   RLTNVPDGIGGLVFNWHLDSKEAQAPIQTLKNMGVWNYKPFSIHITAGPDTIVPGDKLG
FT                   FDLPNNPTMKQHLKNFVATGHEVGSHGGWIHDYYGDNANETNQAQFQPYLVLNRDAVQA
FT                   AIGKPSTEYSAPQGNNPLWAVTWLQQNGVNSFYSLSHTGSAVTRSYRGGGLPNPTMWAV
FT                   PVTPFGVAATFEEFEELLFTEADINKWYKDLIDFSYANETNRMIYAHPPGAVEFPNVMT
FT                   TLLQYANTQQTAGKFRWYTMTRLRNFMVQRSNTTWQSAIAANGKMRVTASNTTTNLVNL
FT                   TWAYPKTKYAKPVAVSGTMSIVDQGTDWLVRITAGKNATFDAAPL"
     MFATIRRSGS GIFRWLYGAI LIFAMGAAQA QNLSKMALLL PDGLAVNDVQ VTAWTDAAQE        60
     QGYQMSILRN ADFLLLGAGA RTQYSGIIVP DQIQVSMSDA LVATIQSYVT QGGNIMLVYD       120
     AGALTANGFY AIPKSRFSDL VGVDYVLYDS LLDRTVGLGP VIGLESTLRA LHIPPGKSIP       180
     YTQTATTVTA LADTPRAIQV ADNGKKAPAG KATADFLPAS PANPGGLKGY DHAQYFKSEP       240
     GVTEGSKERA KKLKQKIIDN KGKKNEKAIQ REAVPGVTPN KLSKDALRNL STSSRIGNPS       300
     LGAKRYLTQA SPPATDPVHA ISGYVYGALT YPSFVTQGTA LGATLMSSPD HGLVASSRTV       360
     GTGSVLFVNL PLTYLKLYED SMPMHGFLHL FARGPAKQPR LTNVPDGIGG LVFNWHLDSK       420
     EAQAPIQTLK NMGVWNYKPF SIHITAGPDT IVPGDKLGFD LPNNPTMKQH LKNFVATGHE       480
     VGSHGGWIHD YYGDNANETN QAQFQPYLVL NRDAVQAAIG KPSTEYSAPQ GNNPLWAVTW       540
     LQQNGVNSFY SLSHTGSAVT RSYRGGGLPN PTMWAVPVTP FGVAATFEEF EELLFTEADI       600
     NKWYKDLIDF SYANETNRMI YAHPPGAVEF PNVMTTLLQY ANTQQTAGKF RWYTMTRLRN       660
     FMVQRSNTTW QSAIAANGKM RVTASNTTTN LVNLTWAYPK TKYAKPVAVS GTMSIVDQGT       720
     DWLVRITAGK NATFDAAPL                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page